missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GPR62 Partial ORF (NP_543141, 314 a.a. - 368 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00118442-Q01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16161597

  • 482.88 € / 25 Mikrogramm

Voraussichtliches Versanddatum: 06-12-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM]

Sequence: RACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPELAGGRSPAYQGPPESSLS
Spezifikation

Spezifikation

NP_543141
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.79kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RACTPQAWHPRALLQCLQRPPEGPAVGPSEAPEQTPELAGGRSPAYQGPPESSLS
RUO
GPR62
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
118442
GPR62 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GPCR8/KPG_005/MGC26943
GPR62
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate