missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GPR82 Partial ORF (NP_543007.1, 237 a.a. - 336 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

310.00 € - 467.00 €

Spezifikation

Name GPR82 (Human) Recombinant Protein (Q01)
Rekombinant Yes
Zur Verwendung mit (Anwendung) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molekulargewicht 36.63kDa
Lagerungsanforderungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16195776
Unterlagen ansehen
Abnova™
H00027197-Q01.25UG
25 ug
467.00 €
25 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab
15-02-2021
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
16185776
Unterlagen ansehen
Abnova™
H00027197-Q01.10UG
10 ug
310.00 €
10 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Verfügbar ab
15-02-2021
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Beschreibung

Beschreibung

Sequence: IMEKDLTYSSVKRHLLVIQILLIVCFLPYSIFKPIFYVLHQRDNCQQLNYLIETKNILTCLASARSSTDPIIFLLLDKTFKKTLYNLFTKSNSAHMQSYG
Spezifikation

Spezifikation

GPR82 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.63kDa
Sicherheitsdatenblatt (SDS)