missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human GRB7 Partial ORF (AAH06535, 37 a.a. - 136 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00002886-Q01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16165731

  • 482.88 € / 25 Mikrogramm

Voraussichtliches Versanddatum: 10-12-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Alternative splicing results in multiple transcript variants encoding different isoforms, although the full-length natures of only two of the variants have been determined to date. [provided by RefSeq]

Sequence: EEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAH
Spezifikation

Spezifikation

AAH06535
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
EEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAH
RUO
GRB7
Yes
wheat germ expression system
Liquid
2886
GRB7 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GRB7
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate