missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human IFI44 (aa 111-194) Control Fragment Recombinant Protein

Artikelnummer. 30197540
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30197540 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30197540 Lieferant Invitrogen™ Lieferanten-Nr. RP94246

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55525 (PA5-55525. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IFI-44 (interferon-induced protein 44), also known as p44 or MTAP44 (microtubule-associated protein 44), is a 444 amino acid protein that localizes to the cytoplasm and, upon induction by IFN-βs, aggregates to form microtubular structures. Human IFI-44 shares 97% sequence similarity with its chimp counterpart, suggesting a conserved role between species. The gene encoding IFI-44 maps to human chromosome 1, which spans 260 million base pairs, contains over 3,000 genes and comprises nearly 8% of the human genome. Chromosome 1 houses a large number of disease-associated genes, including those that are involved in familial adenomatous polyposis, Stickler syndrome, Parkinson's disease, Gaucher disease, schizophrenia and Usher syndrome.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q8TCB0
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 10561
Name Human IFI44 (aa 111-194) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias A430056A10Rik; AW261460; Ifi44; interferon induced protein 44; interferon-induced protein 44; interferon-induced, hepatitis C-associated microtubular aggregate protein (44 kD); microtubule-associated protein 44; Mtap44; p44; TBC/LysM-associated domain containing 5; TLDC5
Gebräuchliche Bezeichnung IFI44
Gensymbol IFI44
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz PTNFQIDGRNRKVIMDLKTMENLGLAQNCTISIQDYEVFRCEDSLDERKIKGVIELRKSLLSALRTYEPYGSLVQQIRILLLGP
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.