missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human KIT Partial ORF (NP_000213, 41 a.a. - 140 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
335.00 € - 508.00 €
Spezifikation
| Zugriffsnummer | NP_000213 |
|---|---|
| Zur Verwendung mit (Anwendung) | Antibody Production, ELISA, Protein Array, Western Blot |
| Zusammensetzung | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gen-ID (Entrez) | 3815 |
| Molekulargewicht | 36.63kDa |
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktcode | Marke | Menge | Preis | Menge & Verfügbarkeit | |||||
|
16160445
|
Abnova™
H00003815-Q01.25UG |
25 ug |
508.00 €
25 Mikrogramm |
Verfügbar ab: 31-05-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
|
16150445
|
Abnova™
H00003815-Q01.10UG |
10 ug |
335.00 €
10 Mikrogramm |
Verfügbar ab: 31-05-2024 Loggen Sie sich ein, um den Lagerbestand zu sehen |
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute! | ||||
Beschreibung
This gene encodes the human homolog of the proto-oncogene c-kit. C-kit was first identified as the cellular homolog of the feline sarcoma viral oncogene v-kit. This protein is a type 3 transmembrane receptor for MGF (mast cell growth factor, also known as stem cell factor). Mutations in this gene are associated with gastrointestinal stromal tumors, mast cell disease, acute myelogenous lukemia, and piebaldism. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Sequence: PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDSpezifikation
| NP_000213 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C-Kit/CD117/PBT/SCFR | |
| KIT | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 3815 | |
| KIT (Human) Recombinant Protein (Q01) | |
| PGKSDLIVRVGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTD | |
| RUO | |
| KIT | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |