missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LTBP2 Partial ORF (NP_000419, 1709 a.a. - 1818 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00004053-Q01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16167471

  • 482.88 € / 25 Mikrogramm

Voraussichtliches Versanddatum: 13-12-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

The protein encoded by this gene belongs to the family of latent transforming growth factor (TGF)-beta binding proteins (LTBP), which are extracellular matrix proteins with multi-domain structure. This protein is the largest member of the LTBP family possessing unique regions and with most similarity to the fibrillins. It has thus been suggested that it may have multiple functions: as a member of the TGF-beta latent complex, as a structural component of microfibrils, and a role in cell adhesion. [provided by RefSeq]

Sequence: LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCT
Spezifikation

Spezifikation

NP_000419
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.84kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
LQPSELQPHYVASHPEPPAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDAAHMACVDVNECDDLNGPAVLCVHGYCENTEGSYRCHCSPGYVAEAGPPHCT
RUO
LTBP2
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4053
LTBP2 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C14orf141/LTBP3/MSTP031
LTBP2
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate