missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MRP1 (aa 226-317) Control Fragment Recombinant Protein

Artikelnummer. 30203125
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30203125 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30203125 Lieferant Invitrogen™ Lieferanten-Nr. RP109526

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutathione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternative splicing by exon deletion results in several splice variants but maintains the original open reading frame in all forms.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P33527
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 4363
Name Human MRP1 (aa 226-317) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias ABC29; ABCC; Abcc1; Abcc1a; Abcc1b; ATP binding cassette subfamily C member 1; ATP-binding cassette sub-family C (CFTR/MRP) member 1 A; ATP-binding cassette sub-family C member 1; ATP-binding cassette transporter variant ABCC1delta-e x 13; ATP-binding cassette transporter variant ABCC1delta-e x 13&14; ATP-binding cassette transporter variant ABCC1delta-e x 25; ATP-binding cassette transporter variant ABCC1delta-e x 25&26; ATP-binding cassette, subfamily C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1; ATP-binding cassette, sub-family C (CFTR/MRP), member 1 A; ATP-binding cassette, sub-family C (CFTR/MRP), member 1 b; Avcc1a; DKFZp686N04233; DKFZp781G125; Glutathione-S-conjugate-translocating ATPase ABCC1; GS-X; leuk; leukotriene C(4) transporter; LTC4 transporter; Mdrap; MRP; Mrp1; multidrug resistance protein 1; multidrug resistance-associated protein 1; multiple drug resistance-associated protein
Gebräuchliche Bezeichnung MRP1
Gensymbol ABCC1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz GLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSPQKEWNPSLFKVL
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.