missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MRPS35 (aa 247-317) Control Fragment Recombinant Protein

Artikelnummer. 30182837
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30182837 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30182837 Lieferant Invitrogen™ Lieferanten-Nr. RP97649

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58421 (PA5-58421. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Mammalian mitochondrial ribosomes (mitoribosomes) are responsible for protein synthesis within the mitochondrion. The mitoribosomes are composed of a 4:1 ratio of protein to RNA, with the proteins forming two subunits, the 28S subunit and the 39S subunit. Across species, the proteins that make up the mitoribosome subunits vary greatly in sequence, preventing easy recognition by sequence homology. MRP-S35 (mitochondrial ribosomal protein S35), also known as MDS023, MRPS28 or HDCMD11P, is a 323 amino acid protein that localizes to the mitochondrion, where it exists as a component of the 28S ribosomal subunit and works in conjunction with other MRPs to mediate protein synthesis. Existing as two alternatively spliced isoforms, MRP-S35 is encoded by a gene located on human chromosome 10, which houses over 1,200 genes and comprises nearly 4. 5% of the human genome.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P82673
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 60488
Name Human MRPS35 (aa 247-317) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 28 S ribosomal protein S28, mitochondrial; 28 S ribosomal protein S35, mitochondrial; HDCMD11P; MDS023; MDSO23; mitochondrial ribosomal protein S28; mitochondrial ribosomal protein S34; mitochondrial ribosomal protein S35; Mitochondrial small ribosomal subunit protein mS35; MRPS28; MRP-S28; Mrps35; MRP-S35; PSEC0213; S28mt; S35mt
Gebräuchliche Bezeichnung MRPS35
Gensymbol MRPS35
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz DMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVK
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.