missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NKX2-8 Partial ORF (NP_055175.2, 3 a.a. - 50 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00026257-Q01.25ug

Weitere Details : Netto-Gewicht : 0.02000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16075385

  • 508.00 € / 25 Mikrogramm
Verfügbar ab: 19-01-2024
Sie sich ein, um den Lagerbestand zu sehen

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

Sequence: TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGH
Spezifikation

Spezifikation

NP_055175.2
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.02kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
TSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGH
RUO
NKX2-8
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
26257
NKX2-8 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NKX2.8/NKX2H/Nkx2-9
NKX2-8
Recombinant
wheat germ expression system
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation

Dokumentation

Zertifikate
Sonderangebote

Sonderangebote