Learn More
Abnova™ Human NOS1 Partial ORF (NP_000611, 1041 a.a. - 1150 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00004842-Q01.10ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. Nitric oxide is synthesized from L-arginine by nitric oxide synthases. This gene encodes a nitric oxide synthase which is highly expressed in skeletal muscle. Genetic variations in this gene are associated with infantile hypertrophic pyloric stenosis type 1
Sequence: FPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPTSpezifikation
NP_000611 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.84kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
FPGNHEDLVNALIERLEDAPPVNQMVKVELLEERNTALGVISNWTDELRLPPCTIFQAFKYYLDITTPPTPLQLQQFASLATSEKEKQRLLVLSKGLQEYEEWKWGKNPT | |
RUO | |
NOS1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
4842 | |
NOS1 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
IHPS1/NOS/nNOS | |
NOS1 | |
Recombinant | |
wheat germ expression system |