missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30194117

Invitrogen™ Human NUAK2 (aa 482-628) Control Fragment Recombinant Protein

Artikelnummer. 30194117
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30194117 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30194117 Lieferant Invitrogen™ Lieferanten-Nr. RP89800

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82371 (PA5-82371. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NUAK2 or SNF1/AMP kinase-related kinase (SNARK) is a member of the NUAK family of SNF1-like kinase 2. NUAK2 is activated by muscle contraction and is a unique mediator of contraction-stimulated glucose transport in skeletal muscle (1). NUAK2 is involved in cellular stress responses linked to obesity and type 2 diabetes. NUAK2 shows kinase activity against a synthetic test peptide and the activity in keratinocytes is increased by AMP and 5-amino-4-imidazolecarboxamide riboside, implying that AMPK kinase-dependent pathway can activate NAUK2. Glucose deprivation also increases NAUK2 activity in baby hamster kidney fibroblasts.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q9H093
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 81788
Name Human NUAK2 (aa 482-628) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 1200013B22Rik; EMBL:AAH81899.1}; mKIAA0537; NUAK family kinase 2; NUAK family SNF1-like kinase 2; NUAK family, SNF1-like kinase, 2; NUAK2; nuak2 {ECO:0000312; Omphalocele kinase 2; Omphk2; SNARK; SNF1/AMP activated protein kinase; SNF1/AMP kinase-related kinase; SNF1/AMP-activated protein kinase; UV126
Gebräuchliche Bezeichnung NUAK2
Gensymbol Nuak2
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.