missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30181796

Invitrogen™ Human NUBP2 (aa 29-80) Control Fragment Recombinant Protein

Artikelnummer. 30181796
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30181796 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30181796 Lieferant Invitrogen™ Lieferanten-Nr. RP98675

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59684 (PA5-59684. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q9Y5Y2
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 10101
Name Human NUBP2 (aa 29-80) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias CFD1; Cytosolic Fe-S cluster assembly factor NUBP2; cytosolic Fe-S cluster assembly factor NUBP2 {ECO:0000255; D17Wsu11e; HAMAP-Rule:MF_03039}; homolog of yeast cytosolic Fe-S cluster deficient 1; NBP 2; NBP 2 {ECO:0000255; NUBP1; Nubp2; nucleotide binding protein 2; nucleotide binding protein 2 (MinD homolog, E. coli); Nucleotide-binding protein 2; nucleotide-binding protein 2 {ECO:0000255
Gebräuchliche Bezeichnung NUBP2
Gensymbol NUBP2
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz STISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVHQCDRGWAPVF
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.