missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PIM3 Partial ORF (NP_001001852.1, 242 a.a. - 326 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00415116-Q01.10ug

Weitere Details : Netto-Gewicht : 0.02000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16045835

  • 320.54 € / 10 Mikrogramm

Verfügbar ab
06-05-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

PIM3 belongs to a family of protooncogenes that encode serine/threonine protein kinases (Mikkers et al., 2004 [PubMed 15199164]).[supplied by OMIM]

Sequence: DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL
Spezifikation

Spezifikation

NP_001001852.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.09kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
DIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGAPESCDLRLCTLDPDDVASTTSSSESL
RUO
PIM3
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
415116
PIM3 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
pim-3
PIM3
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation