missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30212120

Invitrogen™ Human PPP1R8 (aa 177-264) Control Fragment Recombinant Protein

Artikelnummer. 30212120
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30212120 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30212120 Lieferant Invitrogen™ Lieferanten-Nr. RP94133

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55601 (PA5-55601. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q12972
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 5511
Name Human PPP1R8 (aa 177-264) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 6330548N22Rik; activator of RNA decay; ARD1; ARD-1; AU044684; LOC100722083; NIPP1; NIPP-1; NIPP-1, nuclear inhibitor of protein phosphatase-1; Nuclear inhibitor of protein phosphatase 1; nuclear inhibitor of protein phosphatase-1 alpha; nuclear inhibitor of protein phosphatase-1 beta; nuclear subunit of PP-1; Ppp1r8; PRO2047; protein phosphatase 1 regulatory inhibitor subunit 8; protein phosphatase 1 regulatory subunit 8; protein phosphatase 1, regulatory (inhibitor) subunit 8; protein phosphatase 1, regulatory inhibitor subunit 8; protein phosphatase 1, regulatory subunit 8; RNase E
Gebräuchliche Bezeichnung PPP1R8
Gensymbol PPP1R8
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz ISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLY
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.