missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30198208

Invitrogen™ Human PSMD6 (aa 309-381) Control Fragment Recombinant Protein

Artikelnummer. 30198208
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30198208 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30198208 Lieferant Invitrogen™ Lieferanten-Nr. RP96409

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57870 (PA5-57870. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the protease subunit S10 family. The encoded protein is a subunit of the 26S proteasome which colocalizes with DNA damage foci and is involved in the ATP-dependent degradation of ubiquinated proteins. Alternative splicing results in multiple transcript variants.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q15008
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 9861
Name Human PSMD6 (aa 309-381) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 2400006A19Rik; 26 S proteasome non-ATPase regulatory subunit 6; 26 S proteasome non-ATPase regulatory subunit 6-like protein; 26 S proteasome non-ATPase regulatory subunit-like protein; 26 S proteasome regulatory subunit RPN7; 26 S proteasome regulatory subunit S10; breast cancer-associated protein SGA-113 M; KIAA0107; p42A; P44s10; PFAAP4; Phosphonoformate immuno-associated protein 4; proteasome (prosome, macropain) 26 S subunit, non-ATPase, 6; proteasome 26 S subunit, non-ATPase 6; proteasome regulatory particle subunit p44S10; proteasome, 26 S, non-ATPase regulatory subunit 6; PSMD6; Rpn7; S10; SGA-113 M; vov; zgc:56471
Gebräuchliche Bezeichnung PSMD6
Gensymbol PSMD6
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz ESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPDSKNWQYQETIKKGDLLLNRVQ
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.