missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RAB5A Partial ORF (AAH01267, 116 a.a. - 215 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70 € - 518.16 €

Spezifikation

Name RAB5A (Human) Recombinant Protein (Q01)
Rekombinant Yes
Zur Verwendung mit (Anwendung) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molekulargewicht 36.63kDa
Lagerungsbedingungen Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Mehr Spezifikationen ansehen

Produkte 2
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
Produktcode Marke Menge Preis Menge & Verfügbarkeit  
16174005
Unterlagen ansehen Aktionsdetails
Abnova™
H00005868-Q01.25UG
25 ug
518.16 €
25 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Voraussichtliches Versanddatum: 24-01-2022
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
16164005
Unterlagen ansehen Aktionsdetails
Abnova™
H00005868-Q01.10UG
10 ug
341.70 €
10 Mikrogramm
Alternative Produkte anzeigen
Sparen Sie bis zu 
»
Voraussichtliches Versanddatum: 24-01-2022
Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Beschreibung

Beschreibung

Sequence: KELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN
Spezifikation

Spezifikation

RAB5A (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
36.63kDa
Sicherheitsdatenblatt (SDS)
Produktzertifizierungen