missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human RNF167 Partial ORF (NP_056343, 78 a.a. - 172 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00026001-Q01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16167992

  • 482.88 € / 25 Mikrogramm

Voraussichtliches Versanddatum: 10-12-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

RNF167 is an E3 ubiquitin ligase that interacts with TSSC5 (SLC22A18; MIM 602631) and, together with UBCH6 (UBE2E1; MIM 602916), facilitates TSSC5 polyubiquitylation (Yamada and Gorbsky, 2006 [PubMed 16314844]).[supplied by OMIM]

Sequence: VNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYLRALFVYEKGARVLLVPDNTFPLGY
Spezifikation

Spezifikation

NP_056343
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.97kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
VNGSVFIALLRRFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYLRALFVYEKGARVLLVPDNTFPLGY
RUO
RNF167
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
26001
RNF167 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
5730408C10Rik/DKFZp566H073/LP2254/RING105
RNF167
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate