missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SCN9A Partial ORF (NP_002968, 269 a.a. - 339 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00006335-Q01.25ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
This gene encodes a voltage-gated sodium channel which plays a significant role in nociception signaling. Mutations in this gene have been associated with primary erythermalgia, channelopathy-associated insensitivity to pain, and paroxysmal extreme pain disorder. [provided by RefSeq]
Sequence: GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYSpezifikation
| NP_002968 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.55kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GNLKHKCFRNSLENNETLESIMNTLESEEDFRKYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDY | |
| RUO | |
| SCN9A | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 6335 | |
| SCN9A (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ETHA/NE-NA/NENA/Nav1.7/PN1 | |
| SCN9A | |
| Recombinant | |
| wheat germ expression system |