missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30200177

Invitrogen™ Human SELENBP1 (aa 284-418) Control Fragment Recombinant Protein

Artikelnummer. 30200177
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30200177 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30200177 Lieferant Invitrogen™ Lieferanten-Nr. RP88769

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52847 (PA5-52847. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Selenium is an essential trace element that confers tolerance to toxicity arising through exposure to heavy metals or other reactive xenobiotics. Selenium exhibits potent anticarcinogenic properties, and deficiency of selenium may cause certain neurologic diseases. Both effects are attributed to selenium-binding proteins. Selenium binding protein 1 is down-regulated in lung adenocarcinoma, colorectal cander and ovarian cancer. It is two-fold upregulated in the brains of patients suffering from schizophrenia, and is therefore a biomarker for this disease.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q13228
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 8991
Name Human SELENBP1 (aa 284-418) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 56 kDa selenium-binding protein; epididymis secretory sperm binding protein Li 134 P; FLJ13813; HEL-S-134 P; hSBP; hSP56; Lp 56; Lp56; LPSB; Methanethiol oxidase; methanethiol oxidase; selenium-binding protein 1; MTO; SBP; SBP 1; SBP1; SBP56; Selen bp2; SELENBP 1; Selenbp 2; selenbp1; Selenbp2; selenium binding protein 1; selenium binding protein 2; selenium-binding protein 1; Selenium-binding protein 2; SELNBP1; similar to selenium binding protein 1; SP 56; SP56; zgc:65844
Gebräuchliche Bezeichnung SELENBP1
Gensymbol SELENBP1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz TWSVEKVIQVPPKKVKGWLLPEMPGLITDILLSLDDRFLYFSNWLHGDLRQYDISDPQRPRLTGQLFLGGSIVKGGPVQVLEDEELKSQPEPLVVKGKRVAGGPQMIQLSLDGKRLYITTSLYSAWDKQFYPDLI
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.