missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SIRT1 (aa 552-676) Control Fragment Recombinant Protein

Artikelnummer. 30194109
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30194109 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30194109 Lieferant Invitrogen™ Lieferanten-Nr. RP88956

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NAD-dependent protein deacetylase sirtuin-1 (SIRT1) links transcriptional regulation directly to intracellular energetics and participates in the coordination of several separated cellular functions such as cell cycle, repsonse to DNA damage, metabolism, apoptosis, and autophagy. SIRT1 can modulate chromatin function through deacetylation of histones and can promote alterations in the methylation of histone and DNA, leading to transcriptional repression. It is essential in skeletal muscle cell differentiation and in response to low nutrients mediates the inhibitory effect on skeletal myoblast differentiation which also involves 5'-AMP-activated protein kinase (AMPK) and nicotinamide phosphoribosyltransferase (NAMPT).
TRUSTED_SUSTAINABILITY

Spécification

Zugriffsnummer Q96EB6
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 23411
Name Human SIRT1 (aa 552-676) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 75 SirT1; AA673258; hSIR2; hSIRT1; mSIR2a; NAD-dependent deacetylase sirtuin-1; NAD-dependent protein deacetylase sirtuin-1; OTTHUMP00000198111; OTTHUMP00000198112; Regulatory protein SIR2 homolog 1; RP11-57G10.3; SIR2; Sir2a; SIR2alpha; SIR2L1; sir2-like 1; SIR2-like protein 1; SIRT 1; SIRT1; SIRT-1; SirtT1 75 kDa fragment; sirtuin 1; sirtuin 1 ((silent mating type information regulation 2, homolog) 1; sirtuin type 1
Gebräuchliche Bezeichnung SIRT1
Gensymbol SIRT1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz IVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSD
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.