missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC6A11 Partial ORF (NP_055044.1, 164 a.a. - 225 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00006538-Q01.25ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
Gamma-aminobutyric acid (GABA) is a major inhibitory neurotransmitter. GABAergic neurotransmission is terminated by the uptake of GABA into the presynaptic terminal and the surrounding astroglial cells by sodium-dependent transporters, such as SLC6A11.[supplied by OMIM]
Sequence: TELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLRSpezifikation
| NP_055044.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.56kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| TELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLR | |
| RUO | |
| SLC6A11 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 6538 | |
| SLC6A11 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GAT-3/GAT3 | |
| SLC6A11 | |
| Recombinant | |
| wheat germ expression system |