missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30199335

Invitrogen™ Human Syntrophin alpha-1 (aa 371-456) Control Fragment Recombinant Protein

Artikelnummer. 30199335
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30199335 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30199335 Lieferant Invitrogen™ Lieferanten-Nr. RP109123

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Syntrophin alpha-1 (Dystrophin, SNTA1) is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q13424
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 6640
Name Human Syntrophin alpha-1 (aa 371-456) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 59 kDa dystrophin-associated protein A1 acidic component 1; 59-1 DAP; acidic alpha 1 syntrophin; alpha-1-syntrophin; alpha1-syntrophin; alpha-syntrophin; AW228934; dJ1187J4.5; dystrophin-associated protein A1, 59 kDa, acidic component; LQT12; pro-TGF-alpha cytoplasmic domain-interacting protein 1; RP23-192L3.1; SNT1; SNTA1; syntrophin alpha 1; syntrophin, acidic 1; syntrophin, alpha 1; syntrophin, alpha 1 (dystrophin-associated protein A1, 59 kDa, acidic component); syntrophin-1; TACIP1; Unknown (protein for MGC:142519)
Gebräuchliche Bezeichnung Syntrophin alpha-1
Gensymbol SNTA1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.