missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TINAG Partial ORF (NP_055279.2, 2 a.a. - 100 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00027283-Q01.10ug
Weitere Details : Netto-Gewicht : 0.02000kg
Beschreibung
TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.[supplied by OMIM]
Sequence: WTGYKILIFSYLTTEIWMEKRYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNFGCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYKSSpezifikation
| NP_055279.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| WTGYKILIFSYLTTEIWMEKRYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNFGCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYKS | |
| RUO | |
| TINAG | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 27283 | |
| TINAG (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| TIN-AG/TIN1/TIN2 | |
| TINAG | |
| Recombinant | |
| wheat germ expression system |