missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30204182

Invitrogen™ Human TRAP alpha (aa 230-286) Control Fragment Recombinant Protein

Artikelnummer. 30204182
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30204182 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30204182 Lieferant Invitrogen™ Lieferanten-Nr. RP90181

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52811 (PA5-52811. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are exclusively non-canonical.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer P43307
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 6745
Name Human TRAP alpha (aa 230-286) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 2510001K09Rik; 6330400D04; Ac2-238; AI159733; AI452176; cb758; DKFZp781N23103; liver regeneration-related protein LRRG137; PGP35; PSEC0262; signal sequence receptor subunit 1; signal sequence receptor subunit alpha; signal sequence receptor, alpha; signal sequence receptor, alpha (translocon-associated protein alpha); SSR; SSR alpha subunit; SSR1; SSRA precursor protein; SSR-alpha; translocon associated protein alpha; translocon-associated protein alpha; translocon-associated protein alpha subunit; translocon-associated protein subunit alpha; TRAP alpha; TRAPA; TRAP-alpha; unnamed protein product
Gebräuchliche Bezeichnung TRAP alpha
Gensymbol SSR1
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz ESRKRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRLPRKRAQKRSVGSDE
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.