missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30194169

Invitrogen™ Human VGF (aa 514-610) Control Fragment Recombinant Protein

Artikelnummer. 30194169
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30194169 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30194169 Lieferant Invitrogen™ Lieferanten-Nr. RP101768

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63081 (PA5-63081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VGF was initially identified as a rapidly regulated gene product in nerve growth factor-treated PC12 cells. This protein is synthesized in neurons in the central and peripheral nervous system as well as in the pituitary, adrenal medulla, endocrine cells of the stomach, and pancreatic beta cells. VGF is thought to be involved in organism energy balance and regulation of homeostasis as mice lacking this gene show deficits in these areas. More recent results suggest that VGF is upregulated by brain-derived neurotrophic factor (BDNF) and can stimulate the proliferation of hippocampal progenitor cells and produce antidepressant-like behavioral effects, suggesting that this pathway may be a suitable target for therapeutic treatments.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer O15240
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 7425
Name Human VGF (aa 514-610) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias Antimicrobial peptide VGF[554-577 ]; Gm1052; NERP-1; NERP-2; Neuroendocrine regulatory peptide-1; Neuroendocrine regulatory peptide-2; neuro-endocrine specific protein VGF; Neurosecretory protein VGF; SCG7; SgVII; Vgf; VGF nerve growth factor inducible; VGF(180-194); VGF(24-63); VGF(375-407); VGF8a protein; VGF-derived peptide AQEE-30; VGF-derived peptide HFHH-10; VGF-derived peptide LQEQ-19; VGF-derived peptide TLQP-11; VGF-derived peptide TLQP-21; VGF-derived peptide TLQP-30; VGF-derived peptide TLQP-62
Gebräuchliche Bezeichnung VGF
Gensymbol VGF
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz APARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHV
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.