missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Rekombinante Proteine
  4. 30203133

Invitrogen™ Human VISTA (aa 92-185) Control Fragment Recombinant Protein

Artikelnummer. 30203133
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
30203133 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 30203133 Lieferant Invitrogen™ Lieferanten-Nr. RP90094

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52493 (PA5-52493. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VISTA (V-domain Ig containing suppressor of T-cell activation), also known as B7-H5 or PD-1H, is a product of the VSIR gene. Although VISTA bears sequence homology to PD-L1 it has a different expression pattern. In both mouse and humans, VISTA is expressed predominantly on hematopoietic cells with the highest densities on myeloid cells, and lower levels on T cells. It is usually absent on B cells. VISTA expressed by antigen presenting cells has been shown to directly suppress proliferation and cytokine production of CD4 and CD8 T cells, making it a target for cancer immunotherapy. The reported ligands of VISTA include CD28H, VSIG-3 and VSIG-8.
TRUSTED_SUSTAINABILITY

Spezifikation

Zugriffsnummer Q9H7M9
Konzentration ≥5.0 mg/mL
Zur Verwendung mit (Anwendung) Blocking Assay, Control
Zusammensetzung 1 M urea, PBS with no preservative; pH 7.4
Gen-ID (Entrez) 64115
Name Human VISTA (aa 92-185) Control Fragment
Menge 100 μl
Kennzeichnung RUO
Gen-Alias 4632428N05Rik; B7H5; B7-H5; C10orf54; C1H10orf54; C28H10orf54; C4H10orf54; chromosome 10 open reading frame 54; DD1alpha; Death Domain1alpha; Dies1; differentiation of ESCs 1; GI24; PD-1 H; PDCD1 homolog; PD-H1; platelet receptor Gi24; PP2135; RIKEN cDNA 4632428N05 gene; SISP1; sisp-1; Stress-induced secreted protein-1; UNQ730/PRO1412; V-domain Ig suppressor of T cell activation; VISTA; V-set domain-containing immunoregulatory receptor; V-set immunoregulatory receptor; VSIR; V-type immunoglobulin domain-containing suppressor of T-cell activation
Gebräuchliche Bezeichnung VISTA
Gensymbol VSIR
Konjugat Unconjugated
Spezies Human
Rekombinant Recombinant
Proteinmarkierung His-ABP-tag
Sequenz LTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSITMRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYPSSS
Inhalt und Lagerung -20°C, Avoid Freeze/Thaw Cycles
Expressionssystem E. coli
Form Liquid
Reinheits- oder Qualitätsgrad >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.