missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZIC4 Partial ORF (NP_115529, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00084107-Q02.25ug

Weitere Details : Netto-Gewicht : 0.02000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16045715

  • 482.88 € / 25 Mikrogramm

Verfügbar ab
06-05-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function. [provided by RefSeq]

Sequence: MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA
Spezifikation

Spezifikation

NP_115529
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue
MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA
RUO
ZIC4
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
84107
ZIC4 (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ42609|FLJ45833
ZIC4
Yes
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation