missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF607 Full-length ORF (AAH05085.1, 1 a.a. - 156 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marke:  Abnova™ H00084775-P01.10ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16186073

  • 310.00 € / 10 Mikrogramm

Verfügbar ab
12-01-2021

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

Sequence: MAAKVFESIGKFGLALAVAGGMVTSALCNVDAGHRAAIFDQFRGVQNIVVGEGTHFLIPCVQKPIIFDCCSQPRSAPVITGSKDLQNVNITLCILFRPITSQLPRIFTSIGEDYDECVLPFITTEILKSLVARFDAGELITQRELVSSQVSNNLME
Spezifikation

Spezifikation

AAH05085.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
43.3kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ14802|MGC13071
ZNF607
Yes
wheat germ expression system
Liquid
84775
ZNF607 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MAAKVFESIGKFGLALAVAGGMVTSALCNVDAGHRAAIFDQFRGVQNIVVGEGTHFLIPCVQKPIIFDCCSQPRSAPVITGSKDLQNVNITLCILFRPITSQLPRIFTSIGEDYDECVLPFITTEILKSLVARFDAGELITQRELVSSQVSNNLME
RUO
ZNF607
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation