Learn More
Abnova™ Human ZNRD1 Full-length ORF (NP_055411.1, 1 a.a. - 126 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marke: Abnova™ H00030834-P01.10ug
Weitere Details : Netto-Gewicht : 0.00010kg
Beschreibung
This gene encodes a protein with similarity to the Saccharomyces cerevisiae Rpa12p subunit of RNA polymerase I. Alternate splicing of this gene results in two transcript variants encoding the same protein. Additional splice variants have been described, but their full-length sequences have not been determined. [provided by RefSeq]
Sequence: MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDSSpezifikation
NP_055411.1 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
40.3kDa | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HTEX-6/MGC13376/Rpa12/TEX6/hZR14/tctex-6 | |
ZNRD1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, Protein Array, ELISA, Western Blot | |
30834 | |
ZNRD1 (Human) Recombinant Protein (P01) | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MSVMDLANTCSSFQSDLDFCSDCGSVLPLPGAQDTVTCIRCGFNINVRDFEGKVVKTSVVFHQLGTAMPMSVEEGPECQGPVVDRRCPRCGHEGMAYHTRQMRSADEGQTVFYTCTNCKFQEKEDS | |
RUO | |
ZNRD1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |