missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 18243082

ILDR1 Antibody, Novus Biologicals™

Artikelnummer. 18243082 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
100 μL
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18243082 100 μL 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18243082 Lieferant Novus Biologicals Lieferanten-Nr. NBP169697

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

ILDR1 Polyclonal specifically detects ILDR1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen ILDR1
Anwendungen Western Blot
Klassifikation Polyclonal
Konzentration 0.5 mg/ml
Konjugat Unconjugated
Verdünnung Western Blot 1.0 ug/ml
Zusammensetzung PBS, 2% Sucrose with 0.09% Sodium Azide
Gen-Zugriffsnummer Q86SU0-2
Gen-Alias autosomal recessive 42, ILDR1alpha, ILDR1alpha', ILDR1beta, immunoglobulin-like domain containing receptor 1, immunoglobulin-like domain-containing receptor 1 alpha, immunoglobulin-like domain-containing receptor 1 alpha', immunoglobulin-like domain-containing receptor 1 beta
Gensymbole ILDR1
Wirtsspezies Rabbit
Immunogen Synthetic peptides corresponding to ILDR1(immunoglobulin-like domain containing receptor 1) The peptide sequence was selected from the middle region of ILDR1. Peptide sequence RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV.
Molekulargewicht des Antigens 58 kDa
Reinigungsverfahren Affinity purified
Menge 100 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 286676
Testspezifität Equine: 86%; Mouse: 86%; Rat: 79%.
Rekonstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Zielspezies Human, Mouse, Rat, Equine, Guinea Pig
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.