missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
IMP4 Polyclonal specifically detects IMP4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
Spezifikation
| Antigen | IMP4 |
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Zusammensetzung | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gen-Alias | Brix domain-containing protein 4, BXDC4MGC19606, IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast), U3 small nucleolar ribonucleoprotein protein IMP4, U3 snoRNP protein 4 homolog, U3 snoRNP protein IMP4 |
| Gensymbole | IMP4 |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NRLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEYRWAGVEDPKVMITTSRDPSSRLKMFAKE |
| Mehr anzeigen |
For Research Use Only
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?