missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. IMP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

IMP4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Artikelnummer. 18304035 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18304035 100 μg 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18304035 Lieferant Novus Biologicals Lieferanten-Nr. NBP310099100UL

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Rabbit Polyclonal Antibody

IMP4 Polyclonal specifically detects IMP4 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen IMP4
Anwendungen Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot 1.0 ug/ml
Zusammensetzung PBS buffer, 2% sucrose
Gen-Alias Brix domain-containing protein 4, BXDC4MGC19606, IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast), U3 small nucleolar ribonucleoprotein protein IMP4, U3 snoRNP protein 4 homolog, U3 snoRNP protein IMP4
Wirtsspezies Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human IMP4 (NP_001307233.1). Peptide sequence YKKTDHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTAR
Reinigungsverfahren Affinity purified
Menge 100 μg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 92856
Zielspezies Human
Inhalt und Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.