missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen

Artikelnummer. 18234742 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
100 μl
Packungsgröße:
100 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18234742 100 μl 100 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18234742 Lieferant Novus Biologicals™ Lieferanten-Nr. NBP255032PEP

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ISG15 Activating Enzyme/UBE1L. Source: E.coli Amino Acid Sequence: EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR The ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen is derived from E. coli. The ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 7318
Reinigungsverfahren >80% by SDS-PAGE and Coomassie blue staining
Gebräuchliche Bezeichnung ISG15 Activating Enzyme/UBE1L Recombinant Protein Antigen
Inhalt und Lagerung Store at −20°C. Avoid freeze-thaw cycles
Zusammensetzung PBS and 1M Urea, pH 7.4
Zur Verwendung mit (Anwendung) Blocking/Neutralizing, Control
Gen-Alias D8UBA1, ubiquitin-activating enzyme E1 homolog B, UBA1B, UBA7, ubiquitin-activating enzyme E1, UBE1L, UBE2MGC12713, Ubiquitin-activating enzyme 7, Ubiquitin-activating enzyme E1 homolog, ubiquitin-activating enzyme E1-like, ubiquitin-activating enzyme E1-
Gensymbol UBA7
Markertyp Unmarkiert
Produkttyp Recombinant Protein Antigen
Menge 100 μl
Kennzeichnung RUO
Quelle E. coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50386. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mehr anzeigen Weniger anzeigen

Nur für Forschungszwecke.

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.