missing translation for 'onlineSavingsMsg'
Learn More

MAP1LC3A Recombinant Protein, Abnova

Marke:  Abnova H00084557-P01.25ug

Weitere Details : Netto-Gewicht : 0.00010kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 16185953

  • 467.00 € / 25 Mikrogramm

Verfügbar ab
21-12-2020

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!


Beschreibung

Beschreibung

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Spezifikation

Spezifikation

AAH15810.1
Solution
84557
MAP1LC3A (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MAP1LC3A
Human
Yes
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
38.94
8
Glutathione Sepharose 4 Fast Flow
25 ug
MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
LC3|LC3A|MAP1ALC3|MAP1BLC3
MAP1LC3A
Wheat Germ (in vitro)
GST
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation