missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 18317088

MBP-1 Antibody, Novus Biologicals™

Artikelnummer. 18317088 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.05 mg
Packungsgröße:
0.05 Milligramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18317088 0.05 mg 0.05 Milligramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18317088 Lieferant Novus Biologicals Lieferanten-Nr. H00005553B01P

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse Polyclonal Antibody

MBP-1 Polyclonal antibody specifically detects MBP-1 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen MBP-1
Anwendungen Western Blot
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Western Blot
Zusammensetzung PBS (pH 7.4)
Gen-Zugriffsnummer AAH05929.1
Gen-Alias BMPGeosinophil major basic protein, bone marrow proteoglycan, bone-marrow proteoglycan, MBP1, MBPeosinophil granule major basic protein, MGC14537, natural killer cell activator, Proteoglycan 2, proteoglycan 2 preproprotein, proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granulemajor basic protein)
Wirtsspezies Mouse
Immunogen MBP-1 (AAH05929.1, 1 a.a. - 222 a.a.) full-length human protein. MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTQPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAHCLRRLPFICSY
Reinigungsverfahren Protein G purified
Menge 0.05 mg
Regulatorischer Status RUO
Forschungsgebiet Asthma, Immunology
Primär oder sekundär Primary
Gen-ID (Entrez) 5553
Zielspezies Human
Inhalt und Lagerung Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.