missing translation for 'onlineSavingsMsg'
Learn More

MICALL2 Antibody, Novus Biologicals™

Artikelnummer. 18279835 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0.1 mL
25 μL
Packungsgröße:
0.10 Milliliter
25 Mikroliter
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18279835 0.1 mL 0.10 Milliliter
18412031 25 μL 25 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18279835 Lieferant Novus Biologicals Lieferanten-Nr. NBP182073

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Rabbit Polyclonal Antibody

MICALL2 Polyclonal specifically detects MICALL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigen MICALL2
Anwendungen Immunohistochemistry, Immunohistochemistry (Paraffin)
Klassifikation Polyclonal
Konjugat Unconjugated
Verdünnung Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Zusammensetzung PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gen-Alias FLJ41996, FLJ44858, FLJ45410, JRAB, junctional Rab13-binding protein, MICAL-L2, MICAL-like 2, MICAL-like protein 2
Gensymbole MICALL2
Wirtsspezies Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRL
Reinigungsverfahren Affinity Purified
Menge 0.1 mL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 79778
Testspezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Zielspezies Human
Inhalt und Lagerung Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Vedi altri risultati Mostra meno risultati

For Research Use Only

Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.