missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descrizione
MICALL2 Polyclonal specifically detects MICALL2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifica
Specifica
| Antigen | MICALL2 |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gen-Alias | FLJ41996, FLJ44858, FLJ45410, JRAB, junctional Rab13-binding protein, MICAL-L2, MICAL-like 2, MICAL-like protein 2 |
| Gensymbole | MICALL2 |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRL |
| Vedi altri risultati |
For Research Use Only
Titolo del prodotto
Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.
Individuate un'opportunità di miglioramento?