missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 16166912

TXNDC4, Mouse, Polyclonal Antibody, Abnova™

Artikelnummer. 16166912
Change view
Click to view available options
Menge:
50 μL
Packungsgröße:
50 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
16166912 50 μL 50 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 16166912 Lieferant Abnova Lieferanten-Nr. H00023071A01.50uL

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse polyclonal antibody raised against a full-length recombinant TXNDC4.

Sequence: EITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL

Spezifikation

Antigen TXNDC4
Anwendungen ELISA
Klassifikation Polyclonal
Konjugat Unconjugated
Beschreibung Mouse polyclonal antibody raised against a full-length recombinant TXNDC4.
Zusammensetzung 50% glycerol
Gen TXNDC4
Gen-Zugriffsnummer BC005374
Gen-Alias ERP44/KIAA0573
Gensymbole TXNDC4
Wirtsspezies Mouse
Immunogen TXNDC4 (AAH05374, 30 a.a. ∽ 406 a.a) full-length recombinant protein with GST tag.
Menge 50 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 23071
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Antisera
Mehr anzeigen Weniger anzeigen

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.