missing translation for 'onlineSavingsMsg'
Learn More

ZNF274, Mouse, Clone: 4C12, Abnova™

Artikelnummer. 16173176
Change view
Click to view available options
Menge:
200 μL
Packungsgröße:
200 Mikroliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
16173176 200 μL 200 Mikroliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 16173176 Lieferant Abnova Lieferanten-Nr. H00010782M01A.200uL

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Mouse monoclonal antibody raised against a partial recombinant ZNF274.

This gene encodes a zinc finger protein containing five C2H2-type zinc finger domains, one or two Kruppel-associated box A (KRAB A) domains, and a leucine-rich domain. The encoded protein has been suggested to be a transcriptional repressor. It localizes predominantly to the nucleolus. Alternatively spliced transcript variants encoding different isoforms exist. These variants utilize alternative polyadenylation signals. [provided by RefSeq

Sequence: QKIDNPESQANSGALDTNQVLLHKIPPRKRLRKRDSQVKSMKHNSRVKIHQKSCERQKAKEGNGCRKTFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHT

Spezifikation

Antigen ZNF274
Anwendungen ELISA, Western Blot
Klassifikation Monoclonal
Klon 4C12
Konjugat Unconjugated
Beschreibung Mouse monoclonal antibody raised against a partial recombinant ZNF274.
Zusammensetzung ascites with no preservative
Gen ZNF274
Gen-Zugriffsnummer BC009763.2
Gen-Alias DKFZp686K08243/FLJ37843/HFB101/ZF2/ZKSCAN19
Gensymbole ZNF274
Wirtsspezies Mouse
Immunogen ZNF274 (AAH09763.1,420 a.a. ∽ 530 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Menge 200 μL
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 10782
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Form Ascites
Isotype IgG2b κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.