missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
PACRGL Polyclonal specifically detects PACRGL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spezifikation
Spezifikation
| Antigen | PACRGL |
| Anwendungen | Immunocytochemistry, Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Zusammensetzung | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gen-Alias | C4orf28, chromosome 4 open reading frame 28, MGC29898, PACRG-like protein, PARK2 co-regulated-like |
| Gensymbole | PACRGL |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLPRLIPVLKAALVHSDDEVFERGLNALVQLSVVVGPSLNDHLKHLLTSGSLSIIKSKIP |
| Mehr anzeigen |
For Research Use Only
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?