missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
PAP2 Polyclonal antibody specifically detects PAP2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Spezifikation
Spezifikation
| Antigen | PAP2 |
| Anwendungen | Immunofluorescence |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol |
| Gen-Alias | lipid phosphate phosphatase-related protein type 5, phosphatidic acid phosphatase 2d, phosphatidic acid phosphatase type 2, PRG-5 |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PNYTALGCQQYTQFISGEEACTGNPDLIMRARKTFPSKE |
| Reinigungsverfahren | Protein A purified |
| Mehr anzeigen |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?