missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEPT2/SLC15A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marke: Novus Biologicals NBP1-59626
Artikelnummer. 18725743
-
520.00 €
491.40 € / 100 Mikroliter
Sparen 28.60 €
5% Rabatt
Bitte melden Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!
Dieser Artikel kann nicht zurückgegeben werden.
Rückgaberichtlinie anzeigen
Beschreibung
PEPT2/SLC15A2 Polyclonal specifically detects PEPT2/SLC15A2 in Human samples. It is validated for Western Blot.
Spezifikation
| PEPT2/SLC15A2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Kidney H(+)/peptide cotransporter, kidney isoform, PEPT2FLJ33407, Peptide transporter 2, solute carrier family 15 (H+/peptide transporter), member 2, solute carrier family 15 member 2 | |
| Rabbit | |
| 82 kDa | |
| 100 μL | |
| Primary | |
| Rat 79%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q16348 | |
| SLC15A2 | |
| Synthetic peptides corresponding to SLC15A2(solute carrier family 15 (H+/peptide transporter), member 2) The peptide sequence was selected from the middle region of SLC15A2. Peptide sequence GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| 6565 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?
For Research Use Only