missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Descripción
Protein phosphatase 1 inhibitor 3D Polyclonal specifically detects Protein phosphatase 1 inhibitor 3D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Especificaciones
Especificaciones
| Antigen | Protein phosphatase 1 inhibitor 3D |
| Anwendungen | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassifikation | Polyclonal |
| Konjugat | Unconjugated |
| Verdünnung | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Zusammensetzung | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gen-Alias | DKFZp781L2441, PP1 subunit R6, PPP1R6, protein phosphatase 1 regulatory subunit 3D, protein phosphatase 1 regulatory subunit 6, protein phosphatase 1, regulatory subunit 3D, protein phosphatase 1, regulatory subunit 6, spinophilin, protein phosphatase 1-binding subunit R6, regulatory (inhibitor) subunit 3D |
| Gensymbole | PPP1R3D |
| Wirtsspezies | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:ELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDLEFTLHCLVPDFPPPVEAADFGERLQRQLVCLERVTCSDL |
| Mostrar más |
For Research Use Only
Título del producto
Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.
¿Detecta una oportunidad de mejora?