missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Hepatitis B HBsAg preS2 Protein

A cDNA sequence encoding the HBsAg preS2 was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP12129-50ug

Weitere Details : Netto-Gewicht : 0.01000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 15919468

Menge Preis
1 194.62 € / 50 Mikrogramm
10 182.86 € / 50 Mikrogramm
Voraussichtliches Versanddatum: 17-01-2022

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!



Beschreibung

Beschreibung

Spezifikation

Spezifikation

Hepatitis B HBsAg preS2 Protein
50 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Hepatitis B
Untagged
HBsAg protein was lyophilized from 0.2?m filtered (1 mg/ml) solution in 20mM PBS, pH 7.4 and 50mM NaCl.
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote