missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-1 Integrase Protein

A cDNA sequence encoding the HIV-1 Integrase was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP12252-100ug

Weitere Details : Netto-Gewicht : 0.01000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 15919838

Menge Preis
1 220.56 € / 100 Mikrogramm
6 206.97 € / 100 Mikrogramm
Voraussichtliches Versanddatum: 18-01-2022

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!



Beschreibung

Beschreibung

Spezifikation

Spezifikation

HIV-1 Integrase Protein
100 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HIV
His
1.5M urea, 25mM Tris-HCl pH 8.0, 0.2% Triton-X and 50% Glycerol.
Greater than 95.0% as determined by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
mfldgidkaqeehekyhsnwramasdfnlppvvakeivascdkcqlkgeamhgqvdcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfilklagrwpvktihtdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlktavqmavfihnfkrkggiggysagerivdiiatdiqtkelqkqitkiqnfrvyyrdsrdplwkgpakllwkgegavviqdnsdikvvprrkakiirdygkqmagddcvasrqdedhhhhhh
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote