missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Mouse En Protein

A cDNA sequence encoding the En was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP10587-2ug

Weitere Details : Netto-Gewicht : 0.01000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 15914338

Menge Preis
1 129.74 € / 2 Mikrogramm
10 121.33 € / 2 Mikrogramm
Voraussichtliches Versanddatum: 17-01-2022

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!



Beschreibung

Beschreibung

Spezifikation

Spezifikation

13805
Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Eng
Recombinant Protein
Insect
MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVT FTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVF LVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWA ATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTP VQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHGPPYVS WFIDINHSMQILTTGEYSVKIFPGSKVKGVELPDTPQGLIAEARKLNASIVTSFV ELPLVSNVSLRASSCGGVFQTTPAPVVTTPPKDTCSPVLLMSLIQPKCGNQVMT LALNKKHVQTLQCTITGLTFWDSSCQAEDTDDHLVLSSAYSSCGMKVTAHVV SNEVIISFPSGSPPLRKKVQCIDMDSLSFQLGLYLSPHFLQASNTIELGQQAFVQV SVSPLTSEVTVQLDSCHLDLGPEGDMVELIQSRTAKGSCVTLLSPSPEGDPRFSF LLRVYMVPTPTAGTLSCNLALRPSTLSQEVYKTVSMRLNIVSPDLS
En Protein
2 μg
< 1.0 EU per ug protein as determined by the LAL method.
Measured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application.
Mouse
His
Endoglin was lyophilized from a concentrated (1 mg/ml) sterile solution containing no additives.
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote