missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant other Ag85B Protein

A cDNA sequence encoding the Ag85B was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP10977-2ug

Weitere Details : Netto-Gewicht : 0.01000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 15915758

Menge Preis
1 129.74 € / 2 Mikrogramm
10 121.33 € / 2 Mikrogramm
Voraussichtliches Versanddatum: 17-01-2022

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!



Beschreibung

Beschreibung

Spezifikation

Spezifikation

885785
Greater than 90.0% as determined by SDS-PAGE.
Research Use Only
fbpB
Other
His
Lyophilized with 0.1% glycerol.
Ag85B Protein
2 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Recombinant Protein
E. coli
MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote