missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat Tpc1808 Protein

A cDNA sequence encoding the Tpc1808 was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP13791-10ug

Weitere Details : Netto-Gewicht : 0.01000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 15914719

Menge Preis
1 129.74 € / 10 Mikrogramm
10 121.33 € / 10 Mikrogramm
Voraussichtliches Versanddatum: 17-01-2022

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!



Beschreibung

Beschreibung

Spezifikation

Spezifikation

Tpc1808 Protein
10 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Rat
His
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote