missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat Tpc1808 Protein

A cDNA sequence encoding the Tpc1808 was constructed and used to recombinantly synthesize the protein.

Marke:  enQuireBio™ QP13791-1mg

Weitere Details : Netto-Gewicht : 0.01000kg

 Weitere Artikel aus diesem Sortiment

Artikelnummer. 15924719

Menge Preis
1 2578.66 € / 1 Milligramm
3 2424.20 € / 1 Milligramm
Voraussichtliches Versanddatum: 19-01-2022

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!



Beschreibung

Beschreibung

Spezifikation

Spezifikation

Tpc1808 Protein
1 mg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Rat
His
The Tropic-1808 was lyophilized from 1X PBS, pH 7.4.
Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS
Videos
Sicherheitsdatenblatt (SDS)
Dokumentation
Zertifikate
Sonderangebote

Sonderangebote