missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antikörper
  4. Primärantikörper
  5. Alle Primärantikörper
  6. 16174325

RFX5, Mouse anti-Human, Clone: 3B8, Abnova™

Artikelnummer. 16174325
Change view
Click to view available options
Menge:
100 μg
Packungsgröße:
100 Mikrogramm
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
16174325 100 μg 100 Mikrogramm
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 16174325 Lieferant Abnova Lieferanten-Nr. H00005993M02.100ug

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Mouse Monoclonal Antibody

Sequence: ERPGPMGEAEKGAVLAQGQGDGTVSKGGRGPGSQHTKEAEDKIPLVPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP

Spezifikation

Antigen RFX5
Anwendungen ELISA, Western Blot
Klassifikation Monoclonal
Klon 3B8
Konjugat Unconjugated
Zusammensetzung In 1x PBS, pH 7.4
Gen regulatory factor X, 5 (influences HLA class II expression)
Gen-Zugriffsnummer NM_000449
Gen-Alias -
Gensymbole RFX5
Wirtsspezies Mouse
Immunogen RFX5 (NP_000440, 516 a.a. ∼ 616 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Menge 100 μg
Regulatorischer Status RUO
Primär oder sekundär Primary
Gen-ID (Entrez) 5993
Zielspezies Human
Inhalt und Lagerung Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Produkttyp Antibody
Isotype IgG2a κ
Mehr anzeigen Weniger anzeigen
Name des Produkts
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.