missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemische Reagenzien
  4. Peptide
  5. 18172052

Novus Biologicals™ Ryanodine Receptor 1 Recombinant Protein Antigen

Artikelnummer. 18172052 Alle ansehen Bio Techne Produkte
Change view
Click to view available options
Menge:
0,1 mL
Packungsgröße:
0.10 Milliliter
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Menge unitSize
18172052 0,1 mL 0.10 Milliliter
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen
Artikelnummer. 18172052 Lieferant Novus Biologicals™ Lieferanten-Nr. NBP233785PEP

Bitte Sie sich an, um diesen Artikel zu kaufen. Sie benötigen ein Web-Konto? Registrieren Sie sich noch heute!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RYR1. The Ryanodine Receptor 1 Recombinant Protein Antigen is derived from E. coli. The Ryanodine Receptor 1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP2-33785. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 6261
Spezies Human
Proteinfamilie Ryanodine Receptor 1
Reinigungsverfahren Chromatography
Reinheit >80% by SDS-PAGE and Coomassie blue staining
Konzentration 0.5mg/mL
Inhalt und Lagerung Store at -20 C. Avoid freeze-thaw cycles.
Zusammensetzung PBS and 1 M Urea, pH 7.4.
Zur Verwendung mit (Anwendung) Antibody Competition
Gensymbol RYR1
Markertyp Unmarkiert
Molekulargewicht M.W. (theoretical): 26 kDa
Produkttyp Ryanodine Receptor 1
Menge 0,1 mL
Kennzeichnung RUO
Forschungskategorie Neuroscience
Quelle E.Coli
Spezifische Reaktivität This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33785. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen REFLHNNLHLQGKVEGSPSLRWQMALYRGVPGREEDADDPEKIVRRVQEVSAVLYYLDQTEHPYKSKK
Mehr anzeigen Weniger anzeigen

Nur für Forschungszwecke

Produkttitel
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.